Anti APEH pAb (ATL-HPA029700 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029700-25

• 
• 
• 

Protein Description: acylaminoacyl-peptide hydrolase
Gene Name: APEH
Alternative Gene Name: D3F15S2, D3S48E, DNF15S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032590: 86%, ENSRNOG00000029572: 86%
Entrez Gene ID: 327
Uniprot ID: P13798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
• Gene Sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
• Gene ID - Mouse: ENSMUSG00000032590
• Gene ID - Rat: ENSRNOG00000029572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APEH pAb (ATL-HPA029700 w/enhanced validation) – 1 Found

Santhoshkumar, Puttur; Xie, Leike; Raju, Murugesan; Reneker, Lixing; Sharma, K Krishna. Lens crystallin modifications and cataract in transgenic mice overexpressing acylpeptide hydrolase. The Journal Of Biological Chemistry. 2014;289(13):9039-52.