Anti APBB3 pAb (ATL-HPA076196)

Atlas Antibodies

SKU: ATL-HPA076196-25

• 

Protein Description: amyloid beta precursor protein binding family B member 3
Gene Name: APBB3
Alternative Gene Name: FE65L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006050: 91%, ENSRNOG00000017849: 91%
Entrez Gene ID: 10307
Uniprot ID: O95704
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP
• Gene Sequence: LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP
• Gene ID - Mouse: ENSMUSG00000006050
• Gene ID - Rat: ENSRNOG00000017849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.