Anti APBB3 pAb (ATL-HPA076196)

Atlas Antibodies

Catalog No.:
ATL-HPA076196-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: amyloid beta precursor protein binding family B member 3
Gene Name: APBB3
Alternative Gene Name: FE65L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006050: 91%, ENSRNOG00000017849: 91%
Entrez Gene ID: 10307
Uniprot ID: O95704
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP
Gene Sequence LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP
Gene ID - Mouse ENSMUSG00000006050
Gene ID - Rat ENSRNOG00000017849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APBB3 pAb (ATL-HPA076196)
Datasheet Anti APBB3 pAb (ATL-HPA076196) Datasheet (External Link)
Vendor Page Anti APBB3 pAb (ATL-HPA076196) at Atlas Antibodies

Documents & Links for Anti APBB3 pAb (ATL-HPA076196)
Datasheet Anti APBB3 pAb (ATL-HPA076196) Datasheet (External Link)
Vendor Page Anti APBB3 pAb (ATL-HPA076196)