Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017009-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: APBB1IP
Alternative Gene Name: INAG1, RIAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026786: 80%, ENSRNOG00000017803: 81%
Entrez Gene ID: 54518
Uniprot ID: Q7Z5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP |
| Gene Sequence | MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP |
| Gene ID - Mouse | ENSMUSG00000026786 |
| Gene ID - Rat | ENSRNOG00000017803 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) | |
| Datasheet | Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) | |
| Datasheet | Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) |
| Citations for Anti APBB1IP pAb (ATL-HPA017009 w/enhanced validation) – 1 Found |
| Kelley, Kevin W; Nakao-Inoue, Hiromi; Molofsky, Anna V; Oldham, Michael C. Variation among intact tissue samples reveals the core transcriptional features of human CNS cell classes. Nature Neuroscience. 2018;21(9):1171-1184. PubMed |