Anti APBB1 pAb (ATL-HPA038522)

Atlas Antibodies

SKU: ATL-HPA038522-25

• 
• 

Protein Description: amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Gene Name: APBB1
Alternative Gene Name: Fe65, RIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037032: 92%, ENSRNOG00000018020: 90%
Entrez Gene ID: 322
Uniprot ID: O00213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAA
• Gene Sequence: PGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAA
• Gene ID - Mouse: ENSMUSG00000037032
• Gene ID - Rat: ENSRNOG00000018020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.