Anti APBA2 pAb (ATL-HPA058796)

Atlas Antibodies

SKU: ATL-HPA058796-25

• 

Protein Description: amyloid beta precursor protein binding family A member 2
Gene Name: APBA2
Alternative Gene Name: D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030519: 84%, ENSRNOG00000016358: 84%
Entrez Gene ID: 321
Uniprot ID: Q99767
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVL
• Gene Sequence: EEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVL
• Gene ID - Mouse: ENSMUSG00000030519
• Gene ID - Rat: ENSRNOG00000016358
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.