Anti APBA1 pAb (ATL-HPA061287)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061287-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: APBA1
Alternative Gene Name: D9S411E, MINT1, X11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024897: 95%, ENSRNOG00000014928: 95%
Entrez Gene ID: 320
Uniprot ID: Q02410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE |
| Gene Sequence | ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE |
| Gene ID - Mouse | ENSMUSG00000024897 |
| Gene ID - Rat | ENSRNOG00000014928 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APBA1 pAb (ATL-HPA061287) | |
| Datasheet | Anti APBA1 pAb (ATL-HPA061287) Datasheet (External Link) |
| Vendor Page | Anti APBA1 pAb (ATL-HPA061287) at Atlas Antibodies |
| Documents & Links for Anti APBA1 pAb (ATL-HPA061287) | |
| Datasheet | Anti APBA1 pAb (ATL-HPA061287) Datasheet (External Link) |
| Vendor Page | Anti APBA1 pAb (ATL-HPA061287) |