Anti AP5Z1 pAb (ATL-HPA035693 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035693-25

Protein Description: adaptor-related protein complex 5, zeta 1 subunit
Gene Name: AP5Z1
Alternative Gene Name: KIAA0415, SPG48, zeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039623: 84%, ENSRNOG00000056768: 67%
Entrez Gene ID: 9907
Uniprot ID: O43299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
• Gene Sequence: DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
• Gene ID - Mouse: ENSMUSG00000039623
• Gene ID - Rat: ENSRNOG00000056768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AP5Z1 pAb (ATL-HPA035693 w/enhanced validation) – 6 Found

Hirst, Jennifer; Edgar, James R; Esteves, Typhaine; Darios, Frédéric; Madeo, Marianna; Chang, Jaerak; Roda, Ricardo H; Dürr, Alexandra; Anheim, Mathieu; Gellera, Cinzia; Li, Jun; Züchner, Stephan; Mariotti, Caterina; Stevanin, Giovanni; Blackstone, Craig; Kruer, Michael C; Robinson, Margaret S. Loss of AP-5 results in accumulation of aberrant endolysosomes: defining a new type of lysosomal storage disease. Human Molecular Genetics. 2015;24(17):4984-96. 

Hirst, Jennifer; Itzhak, Daniel N; Antrobus, Robin; Borner, Georg H H; Robinson, Margaret S. Role of the AP-5 adaptor protein complex in late endosome-to-Golgi retrieval. Plos Biology. 2018;16(1):e2004411. 

Meng, Delong; Yang, Qianmei; Melick, Chase H; Park, Brenden C; Hsieh, Ting-Sung; Curukovic, Adna; Jeong, Mi-Hyeon; Zhang, Junmei; James, Nicholas G; Jewell, Jenna L. ArfGAP1 inhibits mTORC1 lysosomal localization and activation. The Embo Journal. 2021;40(12):e106412. 

Hirst, Jennifer; Madeo, Marianna; Smets, Katrien; Edgar, James R; Schols, Ludger; Li, Jun; Yarrow, Anna; Deconinck, Tine; Baets, Jonathan; Van Aken, Elisabeth; De Bleecker, Jan; Datiles, Manuel B 3rd; Roda, Ricardo H; Liepert, Joachim; Züchner, Stephan; Mariotti, Caterina; De Jonghe, Peter; Blackstone, Craig; Kruer, Michael C. Complicated spastic paraplegia in patients with AP5Z1 mutations (SPG48). Neurology. Genetics. 2016;2(5):e98. 

Vantaggiato, Chiara; Panzeri, Elena; Castelli, Marianna; Citterio, Andrea; Arnoldi, Alessia; Santorelli, Filippo Maria; Liguori, Rocco; Scarlato, Marina; Musumeci, Olimpia; Toscano, Antonio; Clementi, Emilio; Bassi, Maria Teresa. ZFYVE26/SPASTIZIN and SPG11/SPATACSIN mutations in hereditary spastic paraplegia types AR-SPG15 and AR-SPG11 have different effects on autophagy and endocytosis. Autophagy. 2019;15(1):34-57. 

Hirst, Jennifer; Hesketh, Geoffrey G; Gingras, Anne-Claude; Robinson, Margaret S. Rag GTPases and phosphatidylinositol 3-phosphate mediate recruitment of the AP-5/SPG11/SPG15 complex. The Journal Of Cell Biology. 2021;220(2)