Anti AP5S1 pAb (ATL-HPA043533)

Atlas Antibodies

SKU: ATL-HPA043533-25

• 

Protein Description: adaptor related protein complex 5 sigma 1 subunit
Gene Name: AP5S1
Alternative Gene Name: C20orf29, FLJ11168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068264: 90%, ENSRNOG00000021249: 90%
Entrez Gene ID: 55317
Uniprot ID: Q9NUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW
• Gene Sequence: ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW
• Gene ID - Mouse: ENSMUSG00000068264
• Gene ID - Rat: ENSRNOG00000021249
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.