Anti AP5S1 pAb (ATL-HPA043533)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043533-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AP5S1
Alternative Gene Name: C20orf29, FLJ11168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068264: 90%, ENSRNOG00000021249: 90%
Entrez Gene ID: 55317
Uniprot ID: Q9NUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW |
Gene Sequence | ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW |
Gene ID - Mouse | ENSMUSG00000068264 |
Gene ID - Rat | ENSRNOG00000021249 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AP5S1 pAb (ATL-HPA043533) | |
Datasheet | Anti AP5S1 pAb (ATL-HPA043533) Datasheet (External Link) |
Vendor Page | Anti AP5S1 pAb (ATL-HPA043533) at Atlas Antibodies |
Documents & Links for Anti AP5S1 pAb (ATL-HPA043533) | |
Datasheet | Anti AP5S1 pAb (ATL-HPA043533) Datasheet (External Link) |
Vendor Page | Anti AP5S1 pAb (ATL-HPA043533) |