Anti AP5S1 pAb (ATL-HPA043533)

Atlas Antibodies

Catalog No.:
ATL-HPA043533-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adaptor related protein complex 5 sigma 1 subunit
Gene Name: AP5S1
Alternative Gene Name: C20orf29, FLJ11168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068264: 90%, ENSRNOG00000021249: 90%
Entrez Gene ID: 55317
Uniprot ID: Q9NUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW
Gene Sequence ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW
Gene ID - Mouse ENSMUSG00000068264
Gene ID - Rat ENSRNOG00000021249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP5S1 pAb (ATL-HPA043533)
Datasheet Anti AP5S1 pAb (ATL-HPA043533) Datasheet (External Link)
Vendor Page Anti AP5S1 pAb (ATL-HPA043533) at Atlas Antibodies

Documents & Links for Anti AP5S1 pAb (ATL-HPA043533)
Datasheet Anti AP5S1 pAb (ATL-HPA043533) Datasheet (External Link)
Vendor Page Anti AP5S1 pAb (ATL-HPA043533)