Anti AP4S1 pAb (ATL-HPA039963)

Atlas Antibodies

SKU: ATL-HPA039963-25

• 

Protein Description: adaptor-related protein complex 4, sigma 1 subunit
Gene Name: AP4S1
Alternative Gene Name: AP47B, CLA20, SPG52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020955: 34%, ENSRNOG00000021318: 24%
Entrez Gene ID: 11154
Uniprot ID: Q9Y587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
• Gene Sequence: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
• Gene ID - Mouse: ENSMUSG00000020955
• Gene ID - Rat: ENSRNOG00000021318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.