Anti AP4S1 pAb (ATL-HPA039963)

Atlas Antibodies

SKU:
ATL-HPA039963-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 4, sigma 1 subunit
Gene Name: AP4S1
Alternative Gene Name: AP47B, CLA20, SPG52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020955: 34%, ENSRNOG00000021318: 24%
Entrez Gene ID: 11154
Uniprot ID: Q9Y587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
Gene Sequence LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
Gene ID - Mouse ENSMUSG00000020955
Gene ID - Rat ENSRNOG00000021318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AP4S1 pAb (ATL-HPA039963)
Datasheet Anti AP4S1 pAb (ATL-HPA039963) Datasheet (External Link)
Vendor Page Anti AP4S1 pAb (ATL-HPA039963) at Atlas Antibodies

Documents & Links for Anti AP4S1 pAb (ATL-HPA039963)
Datasheet Anti AP4S1 pAb (ATL-HPA039963) Datasheet (External Link)
Vendor Page Anti AP4S1 pAb (ATL-HPA039963)