Anti AP4M1 pAb (ATL-HPA066774)

Atlas Antibodies

Catalog No.:
ATL-HPA066774-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 4, mu 1 subunit
Gene Name: AP4M1
Alternative Gene Name: MU-4, MU-ARP2, SPG50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019518: 97%, ENSRNOG00000001353: 96%
Entrez Gene ID: 9179
Uniprot ID: O00189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Gene Sequence SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Gene ID - Mouse ENSMUSG00000019518
Gene ID - Rat ENSRNOG00000001353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP4M1 pAb (ATL-HPA066774)
Datasheet Anti AP4M1 pAb (ATL-HPA066774) Datasheet (External Link)
Vendor Page Anti AP4M1 pAb (ATL-HPA066774) at Atlas Antibodies

Documents & Links for Anti AP4M1 pAb (ATL-HPA066774)
Datasheet Anti AP4M1 pAb (ATL-HPA066774) Datasheet (External Link)
Vendor Page Anti AP4M1 pAb (ATL-HPA066774)