Anti AP4E1 pAb (ATL-HPA041749)

Atlas Antibodies

Catalog No.:
ATL-HPA041749-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 4, epsilon 1 subunit
Gene Name: AP4E1
Alternative Gene Name: AP-4-EPSILON, SPG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001998: 70%, ENSRNOG00000022938: 74%
Entrez Gene ID: 23431
Uniprot ID: Q9UPM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMVWSVTNKSGLELKSADLEIFPAENFKVTEQPGCCLPVMEAESTKSFQYSVQIEKPFTEGNLTGFISYHMMDTHSAQLEFSVNLSLLDFIRPLKISSDDFGKLWLSFANDVKQNV
Gene Sequence LMVWSVTNKSGLELKSADLEIFPAENFKVTEQPGCCLPVMEAESTKSFQYSVQIEKPFTEGNLTGFISYHMMDTHSAQLEFSVNLSLLDFIRPLKISSDDFGKLWLSFANDVKQNV
Gene ID - Mouse ENSMUSG00000001998
Gene ID - Rat ENSRNOG00000022938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP4E1 pAb (ATL-HPA041749)
Datasheet Anti AP4E1 pAb (ATL-HPA041749) Datasheet (External Link)
Vendor Page Anti AP4E1 pAb (ATL-HPA041749) at Atlas Antibodies

Documents & Links for Anti AP4E1 pAb (ATL-HPA041749)
Datasheet Anti AP4E1 pAb (ATL-HPA041749) Datasheet (External Link)
Vendor Page Anti AP4E1 pAb (ATL-HPA041749)