Anti AP3S2 pAb (ATL-HPA049270)

Atlas Antibodies

Catalog No.:
ATL-HPA049270-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 3, sigma 2 subunit
Gene Name: AP3S2
Alternative Gene Name: sigma3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063801: 100%, ENSRNOG00000043141: 100%
Entrez Gene ID: 10239
Uniprot ID: P59780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL
Gene Sequence LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL
Gene ID - Mouse ENSMUSG00000063801
Gene ID - Rat ENSRNOG00000043141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP3S2 pAb (ATL-HPA049270)
Datasheet Anti AP3S2 pAb (ATL-HPA049270) Datasheet (External Link)
Vendor Page Anti AP3S2 pAb (ATL-HPA049270) at Atlas Antibodies

Documents & Links for Anti AP3S2 pAb (ATL-HPA049270)
Datasheet Anti AP3S2 pAb (ATL-HPA049270) Datasheet (External Link)
Vendor Page Anti AP3S2 pAb (ATL-HPA049270)