Anti AP3B1 pAb (ATL-HPA038737)

Atlas Antibodies

Catalog No.:
ATL-HPA038737-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 3, beta 1 subunit
Gene Name: AP3B1
Alternative Gene Name: ADTB3A, HPS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021686: 82%, ENSRNOG00000010624: 80%
Entrez Gene ID: 8546
Uniprot ID: O00203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
Gene Sequence VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
Gene ID - Mouse ENSMUSG00000021686
Gene ID - Rat ENSRNOG00000010624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP3B1 pAb (ATL-HPA038737)
Datasheet Anti AP3B1 pAb (ATL-HPA038737) Datasheet (External Link)
Vendor Page Anti AP3B1 pAb (ATL-HPA038737) at Atlas Antibodies

Documents & Links for Anti AP3B1 pAb (ATL-HPA038737)
Datasheet Anti AP3B1 pAb (ATL-HPA038737) Datasheet (External Link)
Vendor Page Anti AP3B1 pAb (ATL-HPA038737)