Anti AP3B1 pAb (ATL-HPA038737)

Atlas Antibodies

Catalog No.: ATL-HPA038737-25

Protein Description: adaptor-related protein complex 3, beta 1 subunit
Gene Name: AP3B1
Alternative Gene Name: ADTB3A, HPS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021686: 82%, ENSRNOG00000010624: 80%
Entrez Gene ID: 8546
Uniprot ID: O00203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
• Gene Sequence: VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
• Gene ID - Mouse: ENSMUSG00000021686
• Gene ID - Rat: ENSRNOG00000010624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.