Anti AP2M1 pAb (ATL-HPA036849)

Atlas Antibodies

SKU: ATL-HPA036849-25

• 

Protein Description: adaptor-related protein complex 2, mu 1 subunit
Gene Name: AP2M1
Alternative Gene Name: AP50, CLAPM1, mu2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022841: 100%, ENSRNOG00000001709: 100%
Entrez Gene ID: 1173
Uniprot ID: Q96CW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
• Gene Sequence: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
• Gene ID - Mouse: ENSMUSG00000022841
• Gene ID - Rat: ENSRNOG00000001709
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.