Anti AP2B1 pAb (ATL-HPA067983)

Atlas Antibodies

Catalog No.:
ATL-HPA067983-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adaptor related protein complex 2 beta 1 subunit
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 98%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
Gene Sequence PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
Gene ID - Mouse ENSMUSG00000035152
Gene ID - Rat ENSRNOG00000061543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP2B1 pAb (ATL-HPA067983)
Datasheet Anti AP2B1 pAb (ATL-HPA067983) Datasheet (External Link)
Vendor Page Anti AP2B1 pAb (ATL-HPA067983) at Atlas Antibodies

Documents & Links for Anti AP2B1 pAb (ATL-HPA067983)
Datasheet Anti AP2B1 pAb (ATL-HPA067983) Datasheet (External Link)
Vendor Page Anti AP2B1 pAb (ATL-HPA067983)