Anti AP2B1 pAb (ATL-HPA067983)

Atlas Antibodies

Catalog No.: ATL-HPA067983-25

Protein Description: adaptor related protein complex 2 beta 1 subunit
Gene Name: AP2B1
Alternative Gene Name: ADTB2, CLAPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035152: 98%, ENSRNOG00000061543: 100%
Entrez Gene ID: 163
Uniprot ID: P63010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
• Gene Sequence: PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
• Gene ID - Mouse: ENSMUSG00000035152
• Gene ID - Rat: ENSRNOG00000061543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.