Anti AP1S1 pAb (ATL-HPA060945)

Atlas Antibodies

SKU:
ATL-HPA060945-100
  • Immunohistochemical staining of human uterus shows moderate cytoplasic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 1, sigma 1 subunit
Gene Name: AP1S1
Alternative Gene Name: AP19, CLAPS1, EKV3, SIGMA1A, WUGSC:H_DJ0747G18.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004849: 100%, ENSRNOG00000001415: 100%
Entrez Gene ID: 1174
Uniprot ID: P61966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Gene Sequence KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Gene ID - Mouse ENSMUSG00000004849
Gene ID - Rat ENSRNOG00000001415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AP1S1 pAb (ATL-HPA060945)
Datasheet Anti AP1S1 pAb (ATL-HPA060945) Datasheet (External Link)
Vendor Page Anti AP1S1 pAb (ATL-HPA060945) at Atlas Antibodies

Documents & Links for Anti AP1S1 pAb (ATL-HPA060945)
Datasheet Anti AP1S1 pAb (ATL-HPA060945) Datasheet (External Link)
Vendor Page Anti AP1S1 pAb (ATL-HPA060945)