Anti AP1S1 pAb (ATL-HPA060945)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060945-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: AP1S1
Alternative Gene Name: AP19, CLAPS1, EKV3, SIGMA1A, WUGSC:H_DJ0747G18.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004849: 100%, ENSRNOG00000001415: 100%
Entrez Gene ID: 1174
Uniprot ID: P61966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KKSVLKAIEQADLLQEEDESPRSVLEEMGLA |
| Gene Sequence | KKSVLKAIEQADLLQEEDESPRSVLEEMGLA |
| Gene ID - Mouse | ENSMUSG00000004849 |
| Gene ID - Rat | ENSRNOG00000001415 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AP1S1 pAb (ATL-HPA060945) | |
| Datasheet | Anti AP1S1 pAb (ATL-HPA060945) Datasheet (External Link) |
| Vendor Page | Anti AP1S1 pAb (ATL-HPA060945) at Atlas Antibodies |
| Documents & Links for Anti AP1S1 pAb (ATL-HPA060945) | |
| Datasheet | Anti AP1S1 pAb (ATL-HPA060945) Datasheet (External Link) |
| Vendor Page | Anti AP1S1 pAb (ATL-HPA060945) |