Anti AP1AR pAb (ATL-HPA058115)

Atlas Antibodies

Catalog No.: ATL-HPA058115-25

Protein Description: adaptor-related protein complex 1 associated regulatory protein
Gene Name: AP1AR
Alternative Gene Name: 2C18, C4orf16, gamma-BAR, PRO0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074238: 88%, ENSRNOG00000024492: 88%
Entrez Gene ID: 55435
Uniprot ID: Q63HQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
• Gene Sequence: RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
• Gene ID - Mouse: ENSMUSG00000074238
• Gene ID - Rat: ENSRNOG00000024492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.