Anti AP1AR pAb (ATL-HPA058115)

Atlas Antibodies

Catalog No.:
ATL-HPA058115-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 1 associated regulatory protein
Gene Name: AP1AR
Alternative Gene Name: 2C18, C4orf16, gamma-BAR, PRO0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074238: 88%, ENSRNOG00000024492: 88%
Entrez Gene ID: 55435
Uniprot ID: Q63HQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
Gene Sequence RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
Gene ID - Mouse ENSMUSG00000074238
Gene ID - Rat ENSRNOG00000024492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP1AR pAb (ATL-HPA058115)
Datasheet Anti AP1AR pAb (ATL-HPA058115) Datasheet (External Link)
Vendor Page Anti AP1AR pAb (ATL-HPA058115) at Atlas Antibodies

Documents & Links for Anti AP1AR pAb (ATL-HPA058115)
Datasheet Anti AP1AR pAb (ATL-HPA058115) Datasheet (External Link)
Vendor Page Anti AP1AR pAb (ATL-HPA058115)