Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035863-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 1 associated regulatory protein
Gene Name: AP1AR
Alternative Gene Name: 2C18, C4orf16, gamma-BAR, PRO0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074238: 90%, ENSRNOG00000024492: 94%
Entrez Gene ID: 55435
Uniprot ID: Q63HQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE
Gene Sequence GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE
Gene ID - Mouse ENSMUSG00000074238
Gene ID - Rat ENSRNOG00000024492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation)
Datasheet Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation)
Datasheet Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation)
Citations for Anti AP1AR pAb (ATL-HPA035863 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed