Anti AP000322.53 pAb (ATL-HPA029085)

Atlas Antibodies

Catalog No.:
ATL-HPA029085-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description:
Gene Name: AP000322.53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 28%, ENSRNOG00000054519: 33%
Entrez Gene ID: 388820
Uniprot ID: A8MWV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS
Gene Sequence NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS
Gene ID - Mouse ENSMUSG00000033596
Gene ID - Rat ENSRNOG00000054519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AP000322.53 pAb (ATL-HPA029085)
Datasheet Anti AP000322.53 pAb (ATL-HPA029085) Datasheet (External Link)
Vendor Page Anti AP000322.53 pAb (ATL-HPA029085) at Atlas Antibodies

Documents & Links for Anti AP000322.53 pAb (ATL-HPA029085)
Datasheet Anti AP000322.53 pAb (ATL-HPA029085) Datasheet (External Link)
Vendor Page Anti AP000322.53 pAb (ATL-HPA029085)