Anti AP000322.53 pAb (ATL-HPA029085)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029085-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AP000322.53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 28%, ENSRNOG00000054519: 33%
Entrez Gene ID: 388820
Uniprot ID: A8MWV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS |
Gene Sequence | NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS |
Gene ID - Mouse | ENSMUSG00000033596 |
Gene ID - Rat | ENSRNOG00000054519 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AP000322.53 pAb (ATL-HPA029085) | |
Datasheet | Anti AP000322.53 pAb (ATL-HPA029085) Datasheet (External Link) |
Vendor Page | Anti AP000322.53 pAb (ATL-HPA029085) at Atlas Antibodies |
Documents & Links for Anti AP000322.53 pAb (ATL-HPA029085) | |
Datasheet | Anti AP000322.53 pAb (ATL-HPA029085) Datasheet (External Link) |
Vendor Page | Anti AP000322.53 pAb (ATL-HPA029085) |