Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040215-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aldehyde oxidase 1
Gene Name: AOX1
Alternative Gene Name: AO, AOH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063558: 70%, ENSRNOG00000015354: 70%
Entrez Gene ID: 316
Uniprot ID: Q06278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVVDIMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPERKLEYGNVDE
Gene Sequence GVVDIMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPERKLEYGNVDE
Gene ID - Mouse ENSMUSG00000063558
Gene ID - Rat ENSRNOG00000015354
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation)
Datasheet Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation)
Datasheet Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation)
Citations for Anti AOX1 pAb (ATL-HPA040215 w/enhanced validation) – 1 Found
Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930.  PubMed