Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA000980-100

• 
• 

Protein Description: amine oxidase, copper containing 3
Gene Name: AOC3
Alternative Gene Name: HPAO, VAP-1, VAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019326: 84%, ENSRNOG00000053448: 82%
Entrez Gene ID: 8639
Uniprot ID: Q16853
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI
• Gene Sequence: DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI
• Gene ID - Mouse: ENSMUSG00000019326
• Gene ID - Rat: ENSRNOG00000053448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) – 5 Found

Ward, Stephen T; Weston, Christopher J; Shepherd, Emma L; Hejmadi, Rahul; Ismail, Tariq; Adams, David H. Evaluation of serum and tissue levels of VAP-1 in colorectal cancer. Bmc Cancer. 2016;16( 26912327):154. 

Bournazou, Eirini; Samuels, Jonathan; Zhou, Hua; Krasnokutsky, Svetlana; Patel, Jyoti; Han, Tianzhen; Bencardino, Jenny; Rybak, Leon; Abramson, Steven B; Junker, Uwe; Brown, Karen S; Attur, Mukundan. Vascular Adhesion Protein-1 (VAP-1) as Predictor of Radiographic Severity in Symptomatic Knee Osteoarthritis in the New York University Cohort. International Journal Of Molecular Sciences. 2019;20(11) 

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Weston, Chris J; Shepherd, Emma L; Claridge, Lee C; Rantakari, Pia; Curbishley, Stuart M; Tomlinson, Jeremy W; Hubscher, Stefan G; Reynolds, Gary M; Aalto, Kristiina; Anstee, Quentin M; Jalkanen, Sirpa; Salmi, Marko; Smith, David J; Day, Christopher P; Adams, David H. Vascular adhesion protein-1 promotes liver inflammation and drives hepatic fibrosis. The Journal Of Clinical Investigation. 2015;125(2):501-20. 

Harden, Sarah L; Zhou, Jieliang; Gharanei, Seley; Diniz-da-Costa, Maria; Lucas, Emma S; Cui, Liang; Murakami, Keisuke; Fang, Jinling; Chen, Qingfeng; Brosens, Jan J; Lee, Yie Hou. Exometabolomic Analysis of Decidualizing Human Endometrial Stromal and Perivascular Cells. Frontiers In Cell And Developmental Biology. 9( 33585482):626619.