Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000980-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: AOC3
Alternative Gene Name: HPAO, VAP-1, VAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019326: 84%, ENSRNOG00000053448: 82%
Entrez Gene ID: 8639
Uniprot ID: Q16853
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI |
| Gene Sequence | DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI |
| Gene ID - Mouse | ENSMUSG00000019326 |
| Gene ID - Rat | ENSRNOG00000053448 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) | |
| Datasheet | Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) | |
| Datasheet | Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) |
| Citations for Anti AOC3 pAb (ATL-HPA000980 w/enhanced validation) – 5 Found |
| Ward, Stephen T; Weston, Christopher J; Shepherd, Emma L; Hejmadi, Rahul; Ismail, Tariq; Adams, David H. Evaluation of serum and tissue levels of VAP-1 in colorectal cancer. Bmc Cancer. 2016;16( 26912327):154. PubMed |
| Bournazou, Eirini; Samuels, Jonathan; Zhou, Hua; Krasnokutsky, Svetlana; Patel, Jyoti; Han, Tianzhen; Bencardino, Jenny; Rybak, Leon; Abramson, Steven B; Junker, Uwe; Brown, Karen S; Attur, Mukundan. Vascular Adhesion Protein-1 (VAP-1) as Predictor of Radiographic Severity in Symptomatic Knee Osteoarthritis in the New York University Cohort. International Journal Of Molecular Sciences. 2019;20(11) PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Weston, Chris J; Shepherd, Emma L; Claridge, Lee C; Rantakari, Pia; Curbishley, Stuart M; Tomlinson, Jeremy W; Hubscher, Stefan G; Reynolds, Gary M; Aalto, Kristiina; Anstee, Quentin M; Jalkanen, Sirpa; Salmi, Marko; Smith, David J; Day, Christopher P; Adams, David H. Vascular adhesion protein-1 promotes liver inflammation and drives hepatic fibrosis. The Journal Of Clinical Investigation. 2015;125(2):501-20. PubMed |
| Harden, Sarah L; Zhou, Jieliang; Gharanei, Seley; Diniz-da-Costa, Maria; Lucas, Emma S; Cui, Liang; Murakami, Keisuke; Fang, Jinling; Chen, Qingfeng; Brosens, Jan J; Lee, Yie Hou. Exometabolomic Analysis of Decidualizing Human Endometrial Stromal and Perivascular Cells. Frontiers In Cell And Developmental Biology. 9( 33585482):626619. PubMed |