Anti ANXA8 pAb (ATL-HPA045246)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045246-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANXA8
Alternative Gene Name: ANX8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021950: 100%, ENSRNOG00000060949: 100%
Entrez Gene ID: 653145
Uniprot ID: P13928
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGTKEGVIIEILASRTKNQLREIMKAYEEDYG |
Gene Sequence | LGTKEGVIIEILASRTKNQLREIMKAYEEDYG |
Gene ID - Mouse | ENSMUSG00000021950 |
Gene ID - Rat | ENSRNOG00000060949 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANXA8 pAb (ATL-HPA045246) | |
Datasheet | Anti ANXA8 pAb (ATL-HPA045246) Datasheet (External Link) |
Vendor Page | Anti ANXA8 pAb (ATL-HPA045246) at Atlas Antibodies |
Documents & Links for Anti ANXA8 pAb (ATL-HPA045246) | |
Datasheet | Anti ANXA8 pAb (ATL-HPA045246) Datasheet (External Link) |
Vendor Page | Anti ANXA8 pAb (ATL-HPA045246) |