Anti ANXA7 pAb (ATL-HPA064290)

Atlas Antibodies

Catalog No.:
ATL-HPA064290-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: annexin A7
Gene Name: ANXA7
Alternative Gene Name: ANX7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021814: 91%, ENSRNOG00000007136: 91%
Entrez Gene ID: 310
Uniprot ID: P20073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAP
Gene Sequence TGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAP
Gene ID - Mouse ENSMUSG00000021814
Gene ID - Rat ENSRNOG00000007136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANXA7 pAb (ATL-HPA064290)
Datasheet Anti ANXA7 pAb (ATL-HPA064290) Datasheet (External Link)
Vendor Page Anti ANXA7 pAb (ATL-HPA064290) at Atlas Antibodies

Documents & Links for Anti ANXA7 pAb (ATL-HPA064290)
Datasheet Anti ANXA7 pAb (ATL-HPA064290) Datasheet (External Link)
Vendor Page Anti ANXA7 pAb (ATL-HPA064290)