Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009650-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ANXA6
Alternative Gene Name: ANX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018340: 95%, ENSRNOG00000010668: 95%
Entrez Gene ID: 309
Uniprot ID: P08133
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED |
| Gene Sequence | IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED |
| Gene ID - Mouse | ENSMUSG00000018340 |
| Gene ID - Rat | ENSRNOG00000010668 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) | |
| Datasheet | Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) | |
| Datasheet | Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) |
| Citations for Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) – 3 Found |
| Nakayama, Hironao; Fukuda, Shinji; Inoue, Hirofumi; Nishida-Fukuda, Hisayo; Shirakata, Yuji; Hashimoto, Koji; Higashiyama, Shigeki. Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin. Molecular Biology Of The Cell. 2012;23(10):1964-75. PubMed |
| Bayés, Alex; Collins, Mark O; Croning, Mike D R; van de Lagemaat, Louie N; Choudhary, Jyoti S; Grant, Seth G N. Comparative study of human and mouse postsynaptic proteomes finds high compositional conservation and abundance differences for key synaptic proteins. Plos One. 7(10):e46683. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |