Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA009650-25

• 
• 

Protein Description: annexin A6
Gene Name: ANXA6
Alternative Gene Name: ANX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018340: 95%, ENSRNOG00000010668: 95%
Entrez Gene ID: 309
Uniprot ID: P08133
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
• Gene Sequence: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
• Gene ID - Mouse: ENSMUSG00000018340
• Gene ID - Rat: ENSRNOG00000010668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANXA6 pAb (ATL-HPA009650 w/enhanced validation) – 3 Found

Nakayama, Hironao; Fukuda, Shinji; Inoue, Hirofumi; Nishida-Fukuda, Hisayo; Shirakata, Yuji; Hashimoto, Koji; Higashiyama, Shigeki. Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin. Molecular Biology Of The Cell. 2012;23(10):1964-75. 

Bayés, Alex; Collins, Mark O; Croning, Mike D R; van de Lagemaat, Louie N; Choudhary, Jyoti S; Grant, Seth G N. Comparative study of human and mouse postsynaptic proteomes finds high compositional conservation and abundance differences for key synaptic proteins. Plos One. 7(10):e46683. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.