Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA013431-25

• 
• 
• 

Protein Description: annexin A3
Gene Name: ANXA3
Alternative Gene Name: ANX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029484: 87%, ENSRNOG00000002045: 80%
Entrez Gene ID: 306
Uniprot ID: P12429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKG
• Gene Sequence: ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKG
• Gene ID - Mouse: ENSMUSG00000029484
• Gene ID - Rat: ENSRNOG00000002045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) – 2 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Huang, Katie; Crist, Angela M; Patel, Nehal R; Blanks, Avery; Carter, Kelsey; Cleaver, Ondine; Meadows, Stryder M. Annexin A3 is necessary for parallel artery-vein alignment in the mouse retina. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2020;249(5):666-678.