Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013431-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ANXA3
Alternative Gene Name: ANX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029484: 87%, ENSRNOG00000002045: 80%
Entrez Gene ID: 306
Uniprot ID: P12429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKG |
| Gene Sequence | ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKG |
| Gene ID - Mouse | ENSMUSG00000029484 |
| Gene ID - Rat | ENSRNOG00000002045 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) | |
| Datasheet | Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) | |
| Datasheet | Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) |
| Citations for Anti ANXA3 pAb (ATL-HPA013431 w/enhanced validation) – 2 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Huang, Katie; Crist, Angela M; Patel, Nehal R; Blanks, Avery; Carter, Kelsey; Cleaver, Ondine; Meadows, Stryder M. Annexin A3 is necessary for parallel artery-vein alignment in the mouse retina. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2020;249(5):666-678. PubMed |