Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA013398-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: annexin A3
Gene Name: ANXA3
Alternative Gene Name: ANX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029484: 94%, ENSRNOG00000002045: 89%
Entrez Gene ID: 306
Uniprot ID: P12429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTD
Gene Sequence ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTD
Gene ID - Mouse ENSMUSG00000029484
Gene ID - Rat ENSRNOG00000002045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation)
Datasheet Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation)
Datasheet Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation)
Citations for Anti ANXA3 pAb (ATL-HPA013398 w/enhanced validation) – 5 Found
Zhang, Zengli; Li, Zhengyiqi; Ma, Zhi; Deng, Meiling; Xing, Manyu; Wu, Jing; Jiang, Shasha; Wang, Qiang; Guo, Qulian; Zou, Wangyuan. Annexin A3 as a Marker Protein for Microglia in the Central Nervous System of Rats. Neural Plasticity. 2021( 34221002):5575090.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Dinets, Andrii; Pernemalm, Maria; Kjellin, Hanna; Sviatoha, Vitalijs; Sofiadis, Anastasios; Juhlin, C Christofer; Zedenius, Jan; Larsson, Catharina; Lehtiö, Janne; Höög, Anders. Differential protein expression profiles of cyst fluid from papillary thyroid carcinoma and benign thyroid lesions. Plos One. 10(5):e0126472.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Merchant, Michael L; Barati, Michelle T; Caster, Dawn J; Hata, Jessica L; Hobeika, Liliane; Coventry, Susan; Brier, Michael E; Wilkey, Daniel W; Li, Ming; Rood, Ilse M; Deegens, Jeroen K; Wetzels, Jack F; Larsen, Christopher P; Troost, Jonathan P; Hodgin, Jeffrey B; Mariani, Laura H; Kretzler, Matthias; Klein, Jon B; McLeish, Kenneth R. Proteomic Analysis Identifies Distinct Glomerular Extracellular Matrix in Collapsing Focal Segmental Glomerulosclerosis. Journal Of The American Society Of Nephrology : Jasn. 2020;31(8):1883-1904.  PubMed