Anti ANXA2R pAb (ATL-HPA051482)

Atlas Antibodies

Catalog No.:
ATL-HPA051482-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: annexin A2 receptor
Gene Name: ANXA2R
Alternative Gene Name: AXIIR, C5orf39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036057: 33%, ENSRNOG00000020862: 30%
Entrez Gene ID: 389289
Uniprot ID: Q3ZCQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR
Gene Sequence EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR
Gene ID - Mouse ENSMUSG00000036057
Gene ID - Rat ENSRNOG00000020862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANXA2R pAb (ATL-HPA051482)
Datasheet Anti ANXA2R pAb (ATL-HPA051482) Datasheet (External Link)
Vendor Page Anti ANXA2R pAb (ATL-HPA051482) at Atlas Antibodies

Documents & Links for Anti ANXA2R pAb (ATL-HPA051482)
Datasheet Anti ANXA2R pAb (ATL-HPA051482) Datasheet (External Link)
Vendor Page Anti ANXA2R pAb (ATL-HPA051482)