Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046964-100
Shipping:
Calculated at Checkout
$520.00
Adding to cart… The item has been added
Protein Description: annexin A2
Gene Name: ANXA2
Alternative Gene Name: ANX2, ANX2L4, CAL1H, LIP2, LPC2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032231: 74%, ENSRNOG00000010362: 75%
Entrez Gene ID: 302
Uniprot ID: P07355
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI
Gene Sequence MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI
Gene ID - Mouse ENSMUSG00000032231
Gene ID - Rat ENSRNOG00000010362
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation)
Datasheet Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation)
Datasheet Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation)
Citations for Anti ANXA2 pAb (ATL-HPA046964 w/enhanced validation) – 2 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Gzil, Arkadiusz; Zarębska, Izabela; Jaworski, Damian; Antosik, Paulina; Durślewicz, Justyna; Maciejewska, Joanna; Domanowska, Ewa; Skoczylas-Makowska, Natalia; Ahmadi, Navid; Grzanka, Dariusz; Szylberg, Łukasz. The prognostic value of leucine-rich repeat-containing G-protein (Lgr5) and its impact on clinicopathological features of colorectal cancer. Journal Of Cancer Research And Clinical Oncology. 2020;146(10):2547-2557.  PubMed