Anti ANXA13 pAb (ATL-HPA018535 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018535-25
  • Immunohistochemistry analysis in human duodenum and pancreas tissues using Anti-ANXA13 antibody. Corresponding ANXA13 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-ANXA13 antibody HPA018535 (A) shows similar pattern to independent antibody HPA019650 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: annexin A13
Gene Name: ANXA13
Alternative Gene Name: ANX13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021866: 32%, ENSRNOG00000010984: 32%
Entrez Gene ID: 312
Uniprot ID: P27216
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTN
Gene Sequence RHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTN
Gene ID - Mouse ENSMUSG00000021866
Gene ID - Rat ENSRNOG00000010984
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANXA13 pAb (ATL-HPA018535 w/enhanced validation)
Datasheet Anti ANXA13 pAb (ATL-HPA018535 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA13 pAb (ATL-HPA018535 w/enhanced validation)