Anti ANXA11 pAb (ATL-HPA027545)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027545-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ANXA11
Alternative Gene Name: ANX11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021866: 84%, ENSRNOG00000010984: 85%
Entrez Gene ID: 311
Uniprot ID: P50995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ |
| Gene Sequence | QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ |
| Gene ID - Mouse | ENSMUSG00000021866 |
| Gene ID - Rat | ENSRNOG00000010984 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA11 pAb (ATL-HPA027545) | |
| Datasheet | Anti ANXA11 pAb (ATL-HPA027545) Datasheet (External Link) |
| Vendor Page | Anti ANXA11 pAb (ATL-HPA027545) at Atlas Antibodies |
| Documents & Links for Anti ANXA11 pAb (ATL-HPA027545) | |
| Datasheet | Anti ANXA11 pAb (ATL-HPA027545) Datasheet (External Link) |
| Vendor Page | Anti ANXA11 pAb (ATL-HPA027545) |
| Citations for Anti ANXA11 pAb (ATL-HPA027545) – 3 Found |
| Shibata, Hideki; Kanadome, Takashi; Sugiura, Hirofumi; Yokoyama, Takeru; Yamamuro, Minami; Moss, Stephen E; Maki, Masatoshi. A new role for annexin A11 in the early secretory pathway via stabilizing Sec31A protein at the endoplasmic reticulum exit sites (ERES). The Journal Of Biological Chemistry. 2015;290(8):4981-4993. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Liao, Ya-Cheng; Fernandopulle, Michael S; Wang, Guozhen; Choi, Heejun; Hao, Ling; Drerup, Catherine M; Patel, Rajan; Qamar, Seema; Nixon-Abell, Jonathon; Shen, Yi; Meadows, William; Vendruscolo, Michele; Knowles, Tuomas P J; Nelson, Matthew; Czekalska, Magdalena A; Musteikyte, Greta; Gachechiladze, Mariam A; Stephens, Christina A; Pasolli, H Amalia; Forrest, Lucy R; St George-Hyslop, Peter; Lippincott-Schwartz, Jennifer; Ward, Michael E. RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether. Cell. 2019;179(1):147-164.e20. PubMed |