Anti ANXA11 pAb (ATL-HPA027545)

Atlas Antibodies

Catalog No.: ATL-HPA027545-25

Protein Description: annexin A11
Gene Name: ANXA11
Alternative Gene Name: ANX11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021866: 84%, ENSRNOG00000010984: 85%
Entrez Gene ID: 311
Uniprot ID: P50995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ
• Gene Sequence: QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ
• Gene ID - Mouse: ENSMUSG00000021866
• Gene ID - Rat: ENSRNOG00000010984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANXA11 pAb (ATL-HPA027545) – 3 Found

Shibata, Hideki; Kanadome, Takashi; Sugiura, Hirofumi; Yokoyama, Takeru; Yamamuro, Minami; Moss, Stephen E; Maki, Masatoshi. A new role for annexin A11 in the early secretory pathway via stabilizing Sec31A protein at the endoplasmic reticulum exit sites (ERES). The Journal Of Biological Chemistry. 2015;290(8):4981-4993. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Liao, Ya-Cheng; Fernandopulle, Michael S; Wang, Guozhen; Choi, Heejun; Hao, Ling; Drerup, Catherine M; Patel, Rajan; Qamar, Seema; Nixon-Abell, Jonathon; Shen, Yi; Meadows, William; Vendruscolo, Michele; Knowles, Tuomas P J; Nelson, Matthew; Czekalska, Magdalena A; Musteikyte, Greta; Gachechiladze, Mariam A; Stephens, Christina A; Pasolli, H Amalia; Forrest, Lucy R; St George-Hyslop, Peter; Lippincott-Schwartz, Jennifer; Ward, Michael E. RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether. Cell. 2019;179(1):147-164.e20.