Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005469-25
  • Immunohistochemistry analysis in human stomach and tonsil tissues using HPA005469 antibody. Corresponding ANXA10 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human stomach tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: annexin A10
Gene Name: ANXA10
Alternative Gene Name: ANX14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031635: 95%, ENSRNOG00000014339: 97%
Entrez Gene ID: 11199
Uniprot ID: Q9UJ72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Gene Sequence PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Gene ID - Mouse ENSMUSG00000031635
Gene ID - Rat ENSRNOG00000014339
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation)
Datasheet Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation)



Citations for Anti ANXA10 pAb (ATL-HPA005469 w/enhanced validation) – 2 Found
Seidlitz, Therese; Chen, Yi-Ting; Uhlemann, Heike; Schölch, Sebastian; Kochall, Susan; Merker, Sebastian R; Klimova, Anna; Hennig, Alexander; Schweitzer, Christine; Pape, Kristin; Baretton, Gustavo B; Welsch, Thilo; Aust, Daniela E; Weitz, Jürgen; Koo, Bon-Kyoung; Stange, Daniel E. Mouse Models of Human Gastric Cancer Subtypes With Stomach-Specific CreERT2-Mediated Pathway Alterations. Gastroenterology. 2019;157(6):1599-1614.e2.  PubMed
Balic, Adam; Chintoan-Uta, Cosmin; Vohra, Prerna; Sutton, Kate M; Cassady-Cain, Robin L; Hu, Tuan; Donaldson, David S; Stevens, Mark P; Mabbott, Neil A; Hume, David A; Sang, Helen M; Vervelde, Lonneke. Antigen Sampling CSF1R-Expressing Epithelial Cells Are the Functional Equivalents of Mammalian M Cells in the Avian Follicle-Associated Epithelium. Frontiers In Immunology. 10( 31695701):2495.  PubMed