Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011272-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ANXA1
Alternative Gene Name: ANX1, LPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024659: 89%, ENSRNOG00000017469: 92%
Entrez Gene ID: 301
Uniprot ID: P04083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG |
| Gene Sequence | MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG |
| Gene ID - Mouse | ENSMUSG00000024659 |
| Gene ID - Rat | ENSRNOG00000017469 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) | |
| Datasheet | Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) | |
| Datasheet | Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) |
| Citations for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) – 3 Found |
| Niinivirta, Marjut; Enblad, Gunilla; Edqvist, Per-Henrik; Pontén, Fredrik; Dragomir, Anca; Ullenhag, Gustav J. Tumoral ANXA1 Is a Predictive Marker for Sunitinib Treatment of Renal Cancer Patients. Journal Of Cancer. 8(19):3975-3983. PubMed |
| Elhassan, Yasir S; Kluckova, Katarina; Fletcher, Rachel S; Schmidt, Mark S; Garten, Antje; Doig, Craig L; Cartwright, David M; Oakey, Lucy; Burley, Claire V; Jenkinson, Ned; Wilson, Martin; Lucas, Samuel J E; Akerman, Ildem; Seabright, Alex; Lai, Yu-Chiang; Tennant, Daniel A; Nightingale, Peter; Wallis, Gareth A; Manolopoulos, Konstantinos N; Brenner, Charles; Philp, Andrew; Lavery, Gareth G. Nicotinamide Riboside Augments the Aged Human Skeletal Muscle NAD(+) Metabolome and Induces Transcriptomic and Anti-inflammatory Signatures. Cell Reports. 2019;28(7):1717-1728.e6. PubMed |
| Elakad, Omar; Li, Yuchan; Gieser, Natascha; Yao, Sha; Küffer, Stefan; Hinterthaner, Marc; Danner, Bernhard C; von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Role of Annexin A1 in Squamous Cell Lung Cancer Progression. Disease Markers. 2021( 33959206):5520832. PubMed |