Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011272-25
  • Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA011272 antibody. Corresponding ANXA1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
  • Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: annexin A1
Gene Name: ANXA1
Alternative Gene Name: ANX1, LPC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024659: 89%, ENSRNOG00000017469: 92%
Entrez Gene ID: 301
Uniprot ID: P04083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Gene Sequence MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Gene ID - Mouse ENSMUSG00000024659
Gene ID - Rat ENSRNOG00000017469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation)
Datasheet Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation)
Datasheet Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation)



Citations for Anti ANXA1 pAb (ATL-HPA011272 w/enhanced validation) – 3 Found
Niinivirta, Marjut; Enblad, Gunilla; Edqvist, Per-Henrik; Pontén, Fredrik; Dragomir, Anca; Ullenhag, Gustav J. Tumoral ANXA1 Is a Predictive Marker for Sunitinib Treatment of Renal Cancer Patients. Journal Of Cancer. 8(19):3975-3983.  PubMed
Elhassan, Yasir S; Kluckova, Katarina; Fletcher, Rachel S; Schmidt, Mark S; Garten, Antje; Doig, Craig L; Cartwright, David M; Oakey, Lucy; Burley, Claire V; Jenkinson, Ned; Wilson, Martin; Lucas, Samuel J E; Akerman, Ildem; Seabright, Alex; Lai, Yu-Chiang; Tennant, Daniel A; Nightingale, Peter; Wallis, Gareth A; Manolopoulos, Konstantinos N; Brenner, Charles; Philp, Andrew; Lavery, Gareth G. Nicotinamide Riboside Augments the Aged Human Skeletal Muscle NAD(+) Metabolome and Induces Transcriptomic and Anti-inflammatory Signatures. Cell Reports. 2019;28(7):1717-1728.e6.  PubMed
Elakad, Omar; Li, Yuchan; Gieser, Natascha; Yao, Sha; Küffer, Stefan; Hinterthaner, Marc; Danner, Bernhard C; von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Role of Annexin A1 in Squamous Cell Lung Cancer Progression. Disease Markers. 2021( 33959206):5520832.  PubMed