Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004625-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: alanyl (membrane) aminopeptidase
Gene Name: ANPEP
Alternative Gene Name: CD13, gp150, LAP1, p150, PEPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039062: 78%, ENSRNOG00000014610: 78%
Entrez Gene ID: 290
Uniprot ID: P15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
Gene Sequence PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
Gene ID - Mouse ENSMUSG00000039062
Gene ID - Rat ENSRNOG00000014610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation)
Datasheet Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation)
Datasheet Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation)
Citations for Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation) – 2 Found
Azimi, Alireza; Tuominen, Rainer; Costa Svedman, Fernanda; Caramuta, Stefano; Pernemalm, Maria; Frostvik Stolt, Marianne; Kanter, Lena; Kharaziha, Pedram; Lehtiö, Janne; Hertzman Johansson, Carolina; Höiom, Veronica; Hansson, Johan; Egyhazi Brage, Suzanne. Silencing FLI or targeting CD13/ANPEP lead to dephosphorylation of EPHA2, a mediator of BRAF inhibitor resistance, and induce growth arrest or apoptosis in melanoma cells. Cell Death & Disease. 2017;8(8):e3029.  PubMed
Wang, Li-Ting; Rajah, Abira; Brown, Claire M; McCaffrey, Luke. CD13 orients the apical-basal polarity axis necessary for lumen formation. Nature Communications. 2021;12(1):4697.  PubMed