Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004625-100

Protein Description: alanyl (membrane) aminopeptidase
Gene Name: ANPEP
Alternative Gene Name: CD13, gp150, LAP1, p150, PEPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039062: 78%, ENSRNOG00000014610: 78%
Entrez Gene ID: 290
Uniprot ID: P15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
• Gene Sequence: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA
• Gene ID - Mouse: ENSMUSG00000039062
• Gene ID - Rat: ENSRNOG00000014610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANPEP pAb (ATL-HPA004625 w/enhanced validation) – 2 Found

Azimi, Alireza; Tuominen, Rainer; Costa Svedman, Fernanda; Caramuta, Stefano; Pernemalm, Maria; Frostvik Stolt, Marianne; Kanter, Lena; Kharaziha, Pedram; Lehtiö, Janne; Hertzman Johansson, Carolina; Höiom, Veronica; Hansson, Johan; Egyhazi Brage, Suzanne. Silencing FLI or targeting CD13/ANPEP lead to dephosphorylation of EPHA2, a mediator of BRAF inhibitor resistance, and induce growth arrest or apoptosis in melanoma cells. Cell Death & Disease. 2017;8(8):e3029. 

Wang, Li-Ting; Rajah, Abira; Brown, Claire M; McCaffrey, Luke. CD13 orients the apical-basal polarity axis necessary for lumen formation. Nature Communications. 2021;12(1):4697.