Anti ANO9 pAb (ATL-HPA039948)

Atlas Antibodies

Catalog No.:
ATL-HPA039948-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: anoctamin 9
Gene Name: ANO9
Alternative Gene Name: PIG5, TMEM16J, TP53I5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054662: 65%, ENSRNOG00000015830: 58%
Entrez Gene ID: 338440
Uniprot ID: A1A5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTTIPVTTRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNY
Gene Sequence PTTIPVTTRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNY
Gene ID - Mouse ENSMUSG00000054662
Gene ID - Rat ENSRNOG00000015830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANO9 pAb (ATL-HPA039948)
Datasheet Anti ANO9 pAb (ATL-HPA039948) Datasheet (External Link)
Vendor Page Anti ANO9 pAb (ATL-HPA039948) at Atlas Antibodies

Documents & Links for Anti ANO9 pAb (ATL-HPA039948)
Datasheet Anti ANO9 pAb (ATL-HPA039948) Datasheet (External Link)
Vendor Page Anti ANO9 pAb (ATL-HPA039948)