Anti ANO9 pAb (ATL-HPA039948)
Atlas Antibodies
- SKU:
- ATL-HPA039948-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANO9
Alternative Gene Name: PIG5, TMEM16J, TP53I5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054662: 65%, ENSRNOG00000015830: 58%
Entrez Gene ID: 338440
Uniprot ID: A1A5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTTIPVTTRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNY |
Gene Sequence | PTTIPVTTRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNY |
Gene ID - Mouse | ENSMUSG00000054662 |
Gene ID - Rat | ENSRNOG00000015830 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANO9 pAb (ATL-HPA039948) | |
Datasheet | Anti ANO9 pAb (ATL-HPA039948) Datasheet (External Link) |
Vendor Page | Anti ANO9 pAb (ATL-HPA039948) at Atlas Antibodies |
Documents & Links for Anti ANO9 pAb (ATL-HPA039948) | |
Datasheet | Anti ANO9 pAb (ATL-HPA039948) Datasheet (External Link) |
Vendor Page | Anti ANO9 pAb (ATL-HPA039948) |