Anti ANO8 pAb (ATL-HPA049206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049206-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANO8
Alternative Gene Name: KIAA1623, TMEM16H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034863: 53%, ENSRNOG00000052236: 27%
Entrez Gene ID: 57719
Uniprot ID: Q9HCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT |
Gene Sequence | REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT |
Gene ID - Mouse | ENSMUSG00000034863 |
Gene ID - Rat | ENSRNOG00000052236 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANO8 pAb (ATL-HPA049206) | |
Datasheet | Anti ANO8 pAb (ATL-HPA049206) Datasheet (External Link) |
Vendor Page | Anti ANO8 pAb (ATL-HPA049206) at Atlas Antibodies |
Documents & Links for Anti ANO8 pAb (ATL-HPA049206) | |
Datasheet | Anti ANO8 pAb (ATL-HPA049206) Datasheet (External Link) |
Vendor Page | Anti ANO8 pAb (ATL-HPA049206) |
Citations for Anti ANO8 pAb (ATL-HPA049206) – 1 Found |
Klee, Katharina M C; Hess, Michael W; Lohmüller, Michael; Herzog, Sebastian; Pfaller, Kristian; Müller, Thomas; Vogel, Georg F; Huber, Lukas A. A CRISPR screen in intestinal epithelial cells identifies novel factors for polarity and apical transport. Elife. 2023;12( 36661306) PubMed |