Anti ANO7 pAb (ATL-HPA035730)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035730-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANO7
Alternative Gene Name: IPCA-5, NGEP, PCANAP5, PCANAP5L, TMEM16G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034107: 37%, ENSRNOG00000023427: 37%
Entrez Gene ID: 50636
Uniprot ID: Q6IWH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ |
| Gene Sequence | VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ |
| Gene ID - Mouse | ENSMUSG00000034107 |
| Gene ID - Rat | ENSRNOG00000023427 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANO7 pAb (ATL-HPA035730) | |
| Datasheet | Anti ANO7 pAb (ATL-HPA035730) Datasheet (External Link) |
| Vendor Page | Anti ANO7 pAb (ATL-HPA035730) at Atlas Antibodies |
| Documents & Links for Anti ANO7 pAb (ATL-HPA035730) | |
| Datasheet | Anti ANO7 pAb (ATL-HPA035730) Datasheet (External Link) |
| Vendor Page | Anti ANO7 pAb (ATL-HPA035730) |
| Citations for Anti ANO7 pAb (ATL-HPA035730) – 1 Found |
| Marx, Andreas; Koopmann, Lena; Höflmayer, Doris; Büscheck, Franziska; Hube-Magg, Claudia; Steurer, Stefan; Eichenauer, Till; Clauditz, Till S; Wilczak, Waldemar; Simon, Ronald; Sauter, Guido; Izbicki, Jakob R; Huland, Hartwig; Heinzer, Hans; Graefen, Markus; Haese, Alexander; Schlomm, Thorsten; Bernreuther, Christian; Lebok, Patrick; Bonk, Sarah. Reduced anoctamin 7 (ANO7) expression is a strong and independent predictor of poor prognosis in prostate cancer. Cancer Biology & Medicine. 2021;18(1):245-255. PubMed |