Anti ANO7 pAb (ATL-HPA035730)

Atlas Antibodies

SKU: ATL-HPA035730-25

• 

Protein Description: anoctamin 7
Gene Name: ANO7
Alternative Gene Name: IPCA-5, NGEP, PCANAP5, PCANAP5L, TMEM16G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034107: 37%, ENSRNOG00000023427: 37%
Entrez Gene ID: 50636
Uniprot ID: Q6IWH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
• Gene Sequence: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
• Gene ID - Mouse: ENSMUSG00000034107
• Gene ID - Rat: ENSRNOG00000023427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANO7 pAb (ATL-HPA035730) – 1 Found

Marx, Andreas; Koopmann, Lena; Höflmayer, Doris; Büscheck, Franziska; Hube-Magg, Claudia; Steurer, Stefan; Eichenauer, Till; Clauditz, Till S; Wilczak, Waldemar; Simon, Ronald; Sauter, Guido; Izbicki, Jakob R; Huland, Hartwig; Heinzer, Hans; Graefen, Markus; Haese, Alexander; Schlomm, Thorsten; Bernreuther, Christian; Lebok, Patrick; Bonk, Sarah. Reduced anoctamin 7 (ANO7) expression is a strong and independent predictor of poor prognosis in prostate cancer. Cancer Biology & Medicine. 2021;18(1):245-255.