Anti ANO6 pAb (ATL-HPA038958)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038958-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ANO6
Alternative Gene Name: DKFZp313M0720, TMEM16F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064210: 86%, ENSRNOG00000006995: 79%
Entrez Gene ID: 196527
Uniprot ID: Q4KMQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLD |
Gene Sequence | EEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLD |
Gene ID - Mouse | ENSMUSG00000064210 |
Gene ID - Rat | ENSRNOG00000006995 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANO6 pAb (ATL-HPA038958) | |
Datasheet | Anti ANO6 pAb (ATL-HPA038958) Datasheet (External Link) |
Vendor Page | Anti ANO6 pAb (ATL-HPA038958) at Atlas Antibodies |
Documents & Links for Anti ANO6 pAb (ATL-HPA038958) | |
Datasheet | Anti ANO6 pAb (ATL-HPA038958) Datasheet (External Link) |
Vendor Page | Anti ANO6 pAb (ATL-HPA038958) |
Citations for Anti ANO6 pAb (ATL-HPA038958) – 8 Found |
Batti, Laura; Sundukova, Mayya; Murana, Emanuele; Pimpinella, Sofia; De Castro Reis, Fernanda; Pagani, Francesca; Wang, Hong; Pellegrino, Eloisa; Perlas, Emerald; Di Angelantonio, Silvia; Ragozzino, Davide; Heppenstall, Paul A. TMEM16F Regulates Spinal Microglial Function in Neuropathic Pain States. Cell Reports. 2016;15(12):2608-15. PubMed |
Acciani, Marissa D; Lay Mendoza, Maria F; Havranek, Katherine E; Duncan, Avery M; Iyer, Hersha; Linn, Olivia L; Brindley, Melinda A. Ebola Virus Requires Phosphatidylserine Scrambling Activity for Efficient Budding and Optimal Infectivity. Journal Of Virology. 2021;95(20):e0116521. PubMed |
Schenk, Laura K; Ousingsawat, Jiraporn; Skryabin, Boris V; Schreiber, Rainer; Pavenstädt, Hermann; Kunzelmann, Karl. Regulation and Function of TMEM16F in Renal Podocytes. International Journal Of Molecular Sciences. 2018;19(6) PubMed |
Le, Trieu; Le, Son C; Yang, Huanghe. Drosophila Subdued is a moonlighting transmembrane protein 16 (TMEM16) that transports ions and phospholipids. The Journal Of Biological Chemistry. 2019;294(12):4529-4537. PubMed |
Zhang, Yang; Le, Trieu; Grabau, Ryan; Mohseni, Zahra; Kim, Hoejeong; Natale, David R; Feng, Liping; Pan, Hua; Yang, Huanghe. TMEM16F phospholipid scramblase mediates trophoblast fusion and placental development. Science Advances. 2020;6(19):eaba0310. PubMed |
Niekamp, Patrick; Scharte, Felix; Sokoya, Tolulope; Vittadello, Laura; Kim, Yeongho; Deng, Yongqiang; Südhoff, Elisabeth; Hilderink, Angelika; Imlau, Mirco; Clarke, Christopher J; Hensel, Michael; Burd, Christopher G; Holthuis, Joost C M. Ca(2+)-activated sphingomyelin scrambling and turnover mediate ESCRT-independent lysosomal repair. Nature Communications. 2022;13(1):1875. PubMed |
Dunning, Kate; Martz, Adeline; Peralta, Francisco Andrés; Cevoli, Federico; Boué-Grabot, Eric; Compan, Vincent; Gautherat, Fanny; Wolf, Patrick; Chataigneau, Thierry; Grutter, Thomas. P2X7 Receptors and TMEM16 Channels Are Functionally Coupled with Implications for Macropore Formation and Current Facilitation. International Journal Of Molecular Sciences. 2021;22(12) PubMed |
Cappelletto, Ambra; Allan, Harriet E; Crescente, Marilena; Schneider, Edoardo; Bussani, Rossana; Ali, Hashim; Secco, Ilaria; Vodret, Simone; Simeone, Roberto; Mascaretti, Luca; Zacchigna, Serena; Warner, Timothy D; Giacca, Mauro. SARS-CoV-2 Spike protein activates TMEM16F-mediated platelet procoagulant activity. Frontiers In Cardiovascular Medicine. 9( 36684586):1013262. PubMed |