Anti ANO5 pAb (ATL-HPA058857)

Atlas Antibodies

Catalog No.:
ATL-HPA058857-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: anoctamin 5
Gene Name: ANO5
Alternative Gene Name: GDD1, LGMD2L, TMEM16E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055489: 87%, ENSRNOG00000015972: 85%
Entrez Gene ID: 203859
Uniprot ID: Q75V66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTSSTEICDPEIGGQMIMCPLCDQVCDYWRLNSTCLASKFSHLFDNE
Gene Sequence NTSSTEICDPEIGGQMIMCPLCDQVCDYWRLNSTCLASKFSHLFDNE
Gene ID - Mouse ENSMUSG00000055489
Gene ID - Rat ENSRNOG00000015972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANO5 pAb (ATL-HPA058857)
Datasheet Anti ANO5 pAb (ATL-HPA058857) Datasheet (External Link)
Vendor Page Anti ANO5 pAb (ATL-HPA058857) at Atlas Antibodies

Documents & Links for Anti ANO5 pAb (ATL-HPA058857)
Datasheet Anti ANO5 pAb (ATL-HPA058857) Datasheet (External Link)
Vendor Page Anti ANO5 pAb (ATL-HPA058857)