Anti ANO10 pAb (ATL-HPA016624)

Atlas Antibodies

Catalog No.:
ATL-HPA016624-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: anoctamin 10
Gene Name: ANO10
Alternative Gene Name: FLJ10375, MGC47890, SCAR10, TMEM16K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037949: 84%, ENSRNOG00000000219: 84%
Entrez Gene ID: 55129
Uniprot ID: Q9NW15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
Gene Sequence ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
Gene ID - Mouse ENSMUSG00000037949
Gene ID - Rat ENSRNOG00000000219
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANO10 pAb (ATL-HPA016624)
Datasheet Anti ANO10 pAb (ATL-HPA016624) Datasheet (External Link)
Vendor Page Anti ANO10 pAb (ATL-HPA016624) at Atlas Antibodies

Documents & Links for Anti ANO10 pAb (ATL-HPA016624)
Datasheet Anti ANO10 pAb (ATL-HPA016624) Datasheet (External Link)
Vendor Page Anti ANO10 pAb (ATL-HPA016624)