Anti ANO10 pAb (ATL-HPA016624)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016624-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANO10
Alternative Gene Name: FLJ10375, MGC47890, SCAR10, TMEM16K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037949: 84%, ENSRNOG00000000219: 84%
Entrez Gene ID: 55129
Uniprot ID: Q9NW15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL |
| Gene Sequence | ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL |
| Gene ID - Mouse | ENSMUSG00000037949 |
| Gene ID - Rat | ENSRNOG00000000219 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANO10 pAb (ATL-HPA016624) | |
| Datasheet | Anti ANO10 pAb (ATL-HPA016624) Datasheet (External Link) |
| Vendor Page | Anti ANO10 pAb (ATL-HPA016624) at Atlas Antibodies |
| Documents & Links for Anti ANO10 pAb (ATL-HPA016624) | |
| Datasheet | Anti ANO10 pAb (ATL-HPA016624) Datasheet (External Link) |
| Vendor Page | Anti ANO10 pAb (ATL-HPA016624) |