Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA032148-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: anoctamin 1, calcium activated chloride channel
Gene Name: ANO1
Alternative Gene Name: DOG1, FLJ10261, ORAOV2, TAOS2, TMEM16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031075: 83%, ENSRNOG00000020865: 83%
Entrez Gene ID: 55107
Uniprot ID: Q5XXA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP
Gene Sequence RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP
Gene ID - Mouse ENSMUSG00000031075
Gene ID - Rat ENSRNOG00000020865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation)
Datasheet Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation)
Datasheet Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation)
Citations for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) – 3 Found
Wang, Fangzhen; Wang, Bo; Long, Junbei; Wang, Fangmin; Wu, Ping. Identification of candidate target genes for endometrial cancer, such as ANO1, using weighted gene co-expression network analysis. Experimental And Therapeutic Medicine. 2019;17(1):298-306.  PubMed
Balázs, Anita; Millar-Büchner, Pamela; Mülleder, Michael; Farztdinov, Vadim; Szyrwiel, Lukasz; Addante, Annalisa; Kuppe, Aditi; Rubil, Tihomir; Drescher, Marika; Seidel, Kathrin; Stricker, Sebastian; Eils, Roland; Lehmann, Irina; Sawitzki, Birgit; Röhmel, Jobst; Ralser, Markus; Mall, Marcus A. Age-Related Differences in Structure and Function of Nasal Epithelial Cultures From Healthy Children and Elderly People. Frontiers In Immunology. 13( 35296085):822437.  PubMed
Zawieja, Scott D; Castorena, Jorge A; Gui, Peichun; Li, Min; Bulley, Simon A; Jaggar, Jonathan H; Rock, Jason R; Davis, Michael J. Ano1 mediates pressure-sensitive contraction frequency changes in mouse lymphatic collecting vessels. The Journal Of General Physiology. 2019;151(4):532-554.  PubMed