Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032148-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ANO1
Alternative Gene Name: DOG1, FLJ10261, ORAOV2, TAOS2, TMEM16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031075: 83%, ENSRNOG00000020865: 83%
Entrez Gene ID: 55107
Uniprot ID: Q5XXA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP |
| Gene Sequence | RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP |
| Gene ID - Mouse | ENSMUSG00000031075 |
| Gene ID - Rat | ENSRNOG00000020865 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) | |
| Datasheet | Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) | |
| Datasheet | Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) |
| Citations for Anti ANO1 pAb (ATL-HPA032148 w/enhanced validation) – 3 Found |
| Wang, Fangzhen; Wang, Bo; Long, Junbei; Wang, Fangmin; Wu, Ping. Identification of candidate target genes for endometrial cancer, such as ANO1, using weighted gene co-expression network analysis. Experimental And Therapeutic Medicine. 2019;17(1):298-306. PubMed |
| Balázs, Anita; Millar-Büchner, Pamela; Mülleder, Michael; Farztdinov, Vadim; Szyrwiel, Lukasz; Addante, Annalisa; Kuppe, Aditi; Rubil, Tihomir; Drescher, Marika; Seidel, Kathrin; Stricker, Sebastian; Eils, Roland; Lehmann, Irina; Sawitzki, Birgit; Röhmel, Jobst; Ralser, Markus; Mall, Marcus A. Age-Related Differences in Structure and Function of Nasal Epithelial Cultures From Healthy Children and Elderly People. Frontiers In Immunology. 13( 35296085):822437. PubMed |
| Zawieja, Scott D; Castorena, Jorge A; Gui, Peichun; Li, Min; Bulley, Simon A; Jaggar, Jonathan H; Rock, Jason R; Davis, Michael J. Ano1 mediates pressure-sensitive contraction frequency changes in mouse lymphatic collecting vessels. The Journal Of General Physiology. 2019;151(4):532-554. PubMed |