Anti ANLN pAb (ATL-HPA005680 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005680-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANLN
Alternative Gene Name: ANILLIN, scra, Scraps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036777: 76%, ENSRNOG00000014343: 76%
Entrez Gene ID: 54443
Uniprot ID: Q9NQW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH |
| Gene Sequence | IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH |
| Gene ID - Mouse | ENSMUSG00000036777 |
| Gene ID - Rat | ENSRNOG00000014343 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) | |
| Datasheet | Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) | |
| Datasheet | Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) |
| Citations for Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) – 4 Found |
| Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35. PubMed |
| O Leary, Patrick C; Penny, Sarah A; Dolan, Roisin T; Kelly, Catherine M; Madden, Stephen F; Rexhepaj, Elton; Brennan, Donal J; McCann, Amanda H; Pontén, Fredrik; Uhlén, Mathias; Zagozdzon, Radoslaw; Duffy, Michael J; Kell, Malcolm R; Jirström, Karin; Gallagher, William M. Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer. Bmc Cancer. 2013;13( 23547718):175. PubMed |
| Magnusson, Kristina; Gremel, Gabriela; Rydén, Lisa; Pontén, Victor; Uhlén, Mathias; Dimberg, Anna; Jirström, Karin; Pontén, Fredrik. ANLN is a prognostic biomarker independent of Ki-67 and essential for cell cycle progression in primary breast cancer. Bmc Cancer. 2016;16(1):904. PubMed |
| Chen, Alexander S; Wardwell-Ozgo, Joanna; Shah, Nilang N; Wright, Deidre; Appin, Christina L; Vigneswaran, Krishanthan; Brat, Daniel J; Kornblum, Harley I; Read, Renee D. Drak/STK17A Drives Neoplastic Glial Proliferation through Modulation of MRLC Signaling. Cancer Research. 2019;79(6):1085-1097. PubMed |