Anti ANLN pAb (ATL-HPA005680 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005680-25

• 
• 

Protein Description: anillin, actin binding protein
Gene Name: ANLN
Alternative Gene Name: ANILLIN, scra, Scraps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036777: 76%, ENSRNOG00000014343: 76%
Entrez Gene ID: 54443
Uniprot ID: Q9NQW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
• Gene Sequence: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
• Gene ID - Mouse: ENSMUSG00000036777
• Gene ID - Rat: ENSRNOG00000014343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANLN pAb (ATL-HPA005680 w/enhanced validation) – 4 Found

Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35. 

O Leary, Patrick C; Penny, Sarah A; Dolan, Roisin T; Kelly, Catherine M; Madden, Stephen F; Rexhepaj, Elton; Brennan, Donal J; McCann, Amanda H; Pontén, Fredrik; Uhlén, Mathias; Zagozdzon, Radoslaw; Duffy, Michael J; Kell, Malcolm R; Jirström, Karin; Gallagher, William M. Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer. Bmc Cancer. 2013;13( 23547718):175. 

Magnusson, Kristina; Gremel, Gabriela; Rydén, Lisa; Pontén, Victor; Uhlén, Mathias; Dimberg, Anna; Jirström, Karin; Pontén, Fredrik. ANLN is a prognostic biomarker independent of Ki-67 and essential for cell cycle progression in primary breast cancer. Bmc Cancer. 2016;16(1):904. 

Chen, Alexander S; Wardwell-Ozgo, Joanna; Shah, Nilang N; Wright, Deidre; Appin, Christina L; Vigneswaran, Krishanthan; Brat, Daniel J; Kornblum, Harley I; Read, Renee D. Drak/STK17A Drives Neoplastic Glial Proliferation through Modulation of MRLC Signaling. Cancer Research. 2019;79(6):1085-1097.