Anti ANKZF1 pAb (ATL-HPA035208)

Atlas Antibodies

SKU: ATL-HPA035208-25

• 
• 
• 

Protein Description: ankyrin repeat and zinc finger domain containing 1
Gene Name: ANKZF1
Alternative Gene Name: FLJ10415, ZNF744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026199: 69%, ENSRNOG00000019052: 68%
Entrez Gene ID: 55139
Uniprot ID: Q9H8Y5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR
• Gene Sequence: YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR
• Gene ID - Mouse: ENSMUSG00000026199
• Gene ID - Rat: ENSRNOG00000019052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANKZF1 pAb (ATL-HPA035208) – 1 Found

van Haaften-Visser, Désirée Y; Harakalova, Magdalena; Mocholi, Enric; van Montfrans, Joris M; Elkadri, Abdul; Rieter, Ester; Fiedler, Karoline; van Hasselt, Peter M; Triffaux, Emily M M; van Haelst, Mieke M; Nijman, Isaac J; Kloosterman, Wigard P; Nieuwenhuis, Edward E S; Muise, Aleixo M; Cuppen, Edwin; Houwen, Roderick H J; Coffer, Paul J. Ankyrin repeat and zinc-finger domain-containing 1 mutations are associated with infantile-onset inflammatory bowel disease. The Journal Of Biological Chemistry. 2017;292(19):7904-7920.