Anti ANKZF1 pAb (ATL-HPA035208)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035208-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ANKZF1
Alternative Gene Name: FLJ10415, ZNF744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026199: 69%, ENSRNOG00000019052: 68%
Entrez Gene ID: 55139
Uniprot ID: Q9H8Y5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene Sequence | YEEDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTVGTLDLCESEVLPKR |
| Gene ID - Mouse | ENSMUSG00000026199 |
| Gene ID - Rat | ENSRNOG00000019052 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) at Atlas Antibodies |
| Documents & Links for Anti ANKZF1 pAb (ATL-HPA035208) | |
| Datasheet | Anti ANKZF1 pAb (ATL-HPA035208) Datasheet (External Link) |
| Vendor Page | Anti ANKZF1 pAb (ATL-HPA035208) |
| Citations for Anti ANKZF1 pAb (ATL-HPA035208) – 1 Found |
| van Haaften-Visser, Désirée Y; Harakalova, Magdalena; Mocholi, Enric; van Montfrans, Joris M; Elkadri, Abdul; Rieter, Ester; Fiedler, Karoline; van Hasselt, Peter M; Triffaux, Emily M M; van Haelst, Mieke M; Nijman, Isaac J; Kloosterman, Wigard P; Nieuwenhuis, Edward E S; Muise, Aleixo M; Cuppen, Edwin; Houwen, Roderick H J; Coffer, Paul J. Ankyrin repeat and zinc-finger domain-containing 1 mutations are associated with infantile-onset inflammatory bowel disease. The Journal Of Biological Chemistry. 2017;292(19):7904-7920. PubMed |