Anti ANKS6 pAb (ATL-HPA008355)

Atlas Antibodies

Catalog No.:
ATL-HPA008355-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and sterile alpha motif domain containing 6
Gene Name: ANKS6
Alternative Gene Name: ANKRD14, FLJ36928, NPHP16, SAMD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066191: 98%, ENSRNOG00000023309: 98%
Entrez Gene ID: 203286
Uniprot ID: Q68DC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Gene Sequence TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Gene ID - Mouse ENSMUSG00000066191
Gene ID - Rat ENSRNOG00000023309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKS6 pAb (ATL-HPA008355)
Datasheet Anti ANKS6 pAb (ATL-HPA008355) Datasheet (External Link)
Vendor Page Anti ANKS6 pAb (ATL-HPA008355) at Atlas Antibodies

Documents & Links for Anti ANKS6 pAb (ATL-HPA008355)
Datasheet Anti ANKS6 pAb (ATL-HPA008355) Datasheet (External Link)
Vendor Page Anti ANKS6 pAb (ATL-HPA008355)
Citations for Anti ANKS6 pAb (ATL-HPA008355) – 4 Found
Taskiran, Ekim Z; Korkmaz, Emine; Gucer, Safak; Kosukcu, Can; Kaymaz, Figen; Koyunlar, Cansu; Bryda, Elizabeth C; Chaki, Moumita; Lu, Dongmei; Vadnagara, Komal; Candan, Cengiz; Topaloglu, Rezan; Schaefer, Franz; Attanasio, Massimo; Bergmann, Carsten; Ozaltin, Fatih. Mutations in ANKS6 cause a nephronophthisis-like phenotype with ESRD. Journal Of The American Society Of Nephrology : Jasn. 2014;25(8):1653-61.  PubMed
Rothé, Benjamin; Leettola, Catherine N; Leal-Esteban, Lucia; Cascio, Duilio; Fortier, Simon; Isenschmid, Manuela; Bowie, James U; Constam, Daniel B. Crystal Structure of Bicc1 SAM Polymer and Mapping of Interactions between the Ciliopathy-Associated Proteins Bicc1, ANKS3, and ANKS6. Structure (London, England : 1993). 2018;26(2):209-224.e6.  PubMed
Hoff, Sylvia; Halbritter, Jan; Epting, Daniel; Frank, Valeska; Nguyen, Thanh-Minh T; van Reeuwijk, Jeroen; Boehlke, Christopher; Schell, Christoph; Yasunaga, Takayuki; Helmstädter, Martin; Mergen, Miriam; Filhol, Emilie; Boldt, Karsten; Horn, Nicola; Ueffing, Marius; Otto, Edgar A; Eisenberger, Tobias; Elting, Mariet W; van Wijk, Joanna A E; Bockenhauer, Detlef; Sebire, Neil J; Rittig, Søren; Vyberg, Mogens; Ring, Troels; Pohl, Martin; Pape, Lars; Neuhaus, Thomas J; Elshakhs, Neveen A Soliman; Koon, Sarah J; Harris, Peter C; Grahammer, Florian; Huber, Tobias B; Kuehn, E Wolfgang; Kramer-Zucker, Albrecht; Bolz, Hanno J; Roepman, Ronald; Saunier, Sophie; Walz, Gerd; Hildebrandt, Friedhelm; Bergmann, Carsten; Lienkamp, Soeren S. ANKS6 is a central component of a nephronophthisis module linking NEK8 to INVS and NPHP3. Nature Genetics. 2013;45(8):951-6.  PubMed
Grampa, Valentina; Delous, Marion; Zaidan, Mohamad; Odye, Gweltas; Thomas, Sophie; Elkhartoufi, Nadia; Filhol, Emilie; Niel, Olivier; Silbermann, Flora; Lebreton, Corinne; Collardeau-Frachon, Sophie; Rouvet, Isabelle; Alessandri, Jean-Luc; Devisme, Louise; Dieux-Coeslier, Anne; Cordier, Marie-Pierre; Capri, Yline; Khung-Savatovsky, Suonavy; Sigaudy, Sabine; Salomon, Rémi; Antignac, Corinne; Gubler, Marie-Claire; Benmerah, Alexandre; Terzi, Fabiola; Attié-Bitach, Tania; Jeanpierre, Cécile; Saunier, Sophie. Novel NEK8 Mutations Cause Severe Syndromic Renal Cystic Dysplasia through YAP Dysregulation. Plos Genetics. 2016;12(3):e1005894.  PubMed