Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061125-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANKS4B
Alternative Gene Name: FLJ38819, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030909: 81%, ENSRNOG00000046181: 78%
Entrez Gene ID: 257629
Uniprot ID: Q8N8V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG |
| Gene Sequence | TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG |
| Gene ID - Mouse | ENSMUSG00000030909 |
| Gene ID - Rat | ENSRNOG00000046181 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) | |
| Datasheet | Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) | |
| Datasheet | Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ANKS4B pAb (ATL-HPA061125 w/enhanced validation) |