Anti ANKS4B pAb (ATL-HPA043523)

Atlas Antibodies

Catalog No.:
ATL-HPA043523-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and sterile alpha motif domain containing 4B
Gene Name: ANKS4B
Alternative Gene Name: FLJ38819, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030909: 77%, ENSRNOG00000046181: 82%
Entrez Gene ID: 257629
Uniprot ID: Q8N8V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP
Gene Sequence VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP
Gene ID - Mouse ENSMUSG00000030909
Gene ID - Rat ENSRNOG00000046181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKS4B pAb (ATL-HPA043523)
Datasheet Anti ANKS4B pAb (ATL-HPA043523) Datasheet (External Link)
Vendor Page Anti ANKS4B pAb (ATL-HPA043523) at Atlas Antibodies

Documents & Links for Anti ANKS4B pAb (ATL-HPA043523)
Datasheet Anti ANKS4B pAb (ATL-HPA043523) Datasheet (External Link)
Vendor Page Anti ANKS4B pAb (ATL-HPA043523)
Citations for Anti ANKS4B pAb (ATL-HPA043523) – 1 Found
Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206.  PubMed