Anti ANKS3 pAb (ATL-HPA041482)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041482-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ANKS3
Alternative Gene Name: FLJ32345, FLJ32767, KIAA1977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022515: 87%, ENSRNOG00000003186: 88%
Entrez Gene ID: 124401
Uniprot ID: Q6ZW76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI |
| Gene Sequence | LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI |
| Gene ID - Mouse | ENSMUSG00000022515 |
| Gene ID - Rat | ENSRNOG00000003186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKS3 pAb (ATL-HPA041482) | |
| Datasheet | Anti ANKS3 pAb (ATL-HPA041482) Datasheet (External Link) |
| Vendor Page | Anti ANKS3 pAb (ATL-HPA041482) at Atlas Antibodies |
| Documents & Links for Anti ANKS3 pAb (ATL-HPA041482) | |
| Datasheet | Anti ANKS3 pAb (ATL-HPA041482) Datasheet (External Link) |
| Vendor Page | Anti ANKS3 pAb (ATL-HPA041482) |