Anti ANKS3 pAb (ATL-HPA041482)

Atlas Antibodies

Catalog No.: ATL-HPA041482-25

Protein Description: ankyrin repeat and sterile alpha motif domain containing 3
Gene Name: ANKS3
Alternative Gene Name: FLJ32345, FLJ32767, KIAA1977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022515: 87%, ENSRNOG00000003186: 88%
Entrez Gene ID: 124401
Uniprot ID: Q6ZW76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI
• Gene Sequence: LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI
• Gene ID - Mouse: ENSMUSG00000022515
• Gene ID - Rat: ENSRNOG00000003186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.