Anti ANKS3 pAb (ATL-HPA041409)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041409-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANKS3
Alternative Gene Name: FLJ32345, FLJ32767, KIAA1977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022515: 63%, ENSRNOG00000003186: 63%
Entrez Gene ID: 124401
Uniprot ID: Q6ZW76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD |
Gene Sequence | REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD |
Gene ID - Mouse | ENSMUSG00000022515 |
Gene ID - Rat | ENSRNOG00000003186 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKS3 pAb (ATL-HPA041409) | |
Datasheet | Anti ANKS3 pAb (ATL-HPA041409) Datasheet (External Link) |
Vendor Page | Anti ANKS3 pAb (ATL-HPA041409) at Atlas Antibodies |
Documents & Links for Anti ANKS3 pAb (ATL-HPA041409) | |
Datasheet | Anti ANKS3 pAb (ATL-HPA041409) Datasheet (External Link) |
Vendor Page | Anti ANKS3 pAb (ATL-HPA041409) |