Anti ANKS3 pAb (ATL-HPA041409)

Atlas Antibodies

Catalog No.:
ATL-HPA041409-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and sterile alpha motif domain containing 3
Gene Name: ANKS3
Alternative Gene Name: FLJ32345, FLJ32767, KIAA1977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022515: 63%, ENSRNOG00000003186: 63%
Entrez Gene ID: 124401
Uniprot ID: Q6ZW76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD
Gene Sequence REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD
Gene ID - Mouse ENSMUSG00000022515
Gene ID - Rat ENSRNOG00000003186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKS3 pAb (ATL-HPA041409)
Datasheet Anti ANKS3 pAb (ATL-HPA041409) Datasheet (External Link)
Vendor Page Anti ANKS3 pAb (ATL-HPA041409) at Atlas Antibodies

Documents & Links for Anti ANKS3 pAb (ATL-HPA041409)
Datasheet Anti ANKS3 pAb (ATL-HPA041409) Datasheet (External Link)
Vendor Page Anti ANKS3 pAb (ATL-HPA041409)