Anti ANKS1A pAb (ATL-HPA036769)

Atlas Antibodies

SKU:
ATL-HPA036769-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and sterile alpha motif domain containing 1A
Gene Name: ANKS1A
Alternative Gene Name: ANKS1, KIAA0229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024219: 74%, ENSRNOG00000000498: 72%
Entrez Gene ID: 23294
Uniprot ID: Q92625
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETKKVVLVDGKTKDHRRSSSSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLCTAGQSHPDGSPQQGACHKASMQLEETGVHAPG
Gene Sequence ETKKVVLVDGKTKDHRRSSSSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLCTAGQSHPDGSPQQGACHKASMQLEETGVHAPG
Gene ID - Mouse ENSMUSG00000024219
Gene ID - Rat ENSRNOG00000000498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKS1A pAb (ATL-HPA036769)
Datasheet Anti ANKS1A pAb (ATL-HPA036769) Datasheet (External Link)
Vendor Page Anti ANKS1A pAb (ATL-HPA036769) at Atlas Antibodies

Documents & Links for Anti ANKS1A pAb (ATL-HPA036769)
Datasheet Anti ANKS1A pAb (ATL-HPA036769) Datasheet (External Link)
Vendor Page Anti ANKS1A pAb (ATL-HPA036769)