Anti ANKRD7 pAb (ATL-HPA043489)

Atlas Antibodies

Catalog No.:
ATL-HPA043489-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 7
Gene Name: ANKRD7
Alternative Gene Name: TSA806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029517: 34%, ENSRNOG00000055481: 37%
Entrez Gene ID: 56311
Uniprot ID: Q92527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTALILAVSGEPPCLVKLLLQQGVELCYEGIVDSQLRNMFISMVLLHRYPQFTASHGKKKHA
Gene Sequence RTALILAVSGEPPCLVKLLLQQGVELCYEGIVDSQLRNMFISMVLLHRYPQFTASHGKKKHA
Gene ID - Mouse ENSMUSG00000029517
Gene ID - Rat ENSRNOG00000055481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD7 pAb (ATL-HPA043489)
Datasheet Anti ANKRD7 pAb (ATL-HPA043489) Datasheet (External Link)
Vendor Page Anti ANKRD7 pAb (ATL-HPA043489) at Atlas Antibodies

Documents & Links for Anti ANKRD7 pAb (ATL-HPA043489)
Datasheet Anti ANKRD7 pAb (ATL-HPA043489) Datasheet (External Link)
Vendor Page Anti ANKRD7 pAb (ATL-HPA043489)