Anti ANKRD61 pAb (ATL-HPA029511)

Atlas Antibodies

Catalog No.:
ATL-HPA029511-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 61
Gene Name: ANKRD61
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029607: 65%, ENSRNOG00000001048: 74%
Entrez Gene ID: 100310846
Uniprot ID: A6NGH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTDIQNSSITCLRILCAHGAQVNTQGEISNKRSPLHL
Gene Sequence SLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTDIQNSSITCLRILCAHGAQVNTQGEISNKRSPLHL
Gene ID - Mouse ENSMUSG00000029607
Gene ID - Rat ENSRNOG00000001048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD61 pAb (ATL-HPA029511)
Datasheet Anti ANKRD61 pAb (ATL-HPA029511) Datasheet (External Link)
Vendor Page Anti ANKRD61 pAb (ATL-HPA029511) at Atlas Antibodies

Documents & Links for Anti ANKRD61 pAb (ATL-HPA029511)
Datasheet Anti ANKRD61 pAb (ATL-HPA029511) Datasheet (External Link)
Vendor Page Anti ANKRD61 pAb (ATL-HPA029511)